rawrr - Direct Access to Orbitrap Data and Beyond
This package wraps the functionality of the Thermo Fisher Scientic RawFileReader .NET 8.0 assembly. Within the R environment, spectra and chromatograms are represented by S3 objects. The package provides basic functions to download and install the required third-party libraries. The package is developed, tested, and used at the Functional Genomics Center Zurich, Switzerland.
Last updated
massspectrometryproteomicsmetabolomicsinfrastructuresoftwarefastmass-spectrometrymultiplatformorbitrap-ms
8.62 score 62 stars 3 dependents 74 scripts 468 downloadsprotViz - Visualizing and Analyzing Mass Spectrometry Related Data in Proteomics
Helps with quality checks, visualizations and analysis of mass spectrometry data, coming from proteomics experiments. The package is developed, tested and used at the Functional Genomics Center Zurich <https://fgcz.ch>. We use this package mainly for prototyping, teaching, and having fun with proteomics data. But it can also be used to do data analysis for small scale data sets.
Last updated
funmass-spectrometrypeptide-identificationproteomicsquantificationvisualizationcpp
8.00 score 11 stars 2 dependents 94 scripts 570 downloadsrawDiag - Brings Orbitrap Mass Spectrometry Data to Life; Fast and Colorful
Optimizing methods for liquid chromatography coupled to mass spectrometry (LC-MS) poses a nontrivial challenge. The rawDiag package facilitates rational method optimization by generating MS operator-tailored diagnostic plots of scan-level metadata. The package is designed for use on the R shell or as a Shiny application on the Orbitrap instrument PC.
Last updated
massspectrometryproteomicsmetabolomicsinfrastructuresoftwareshinyappsfastmass-spectrometrymultiplatformorbitrapvisualization
6.14 score 37 stars 25 scripts 256 downloadsrecmap - Compute the Rectangular Statistical Cartogram
Implements the RecMap MP2 construction heuristic (<doi:10.1109/INFVIS.2004.57>). This algorithm draws maps according to a given statistical value (e.g., election results, population, or epidemiological data). The basic idea of the RecMap algorithm is that each map region (e.g., a country) is represented by a rectangle whose area reflects the provided statistical value, thereby maintaining zero cartographic error. Computationally intensive tasks are implemented in C++. The included vignette documents usage of the recmap algorithm.
Last updated
cartogramdemographicsgenetic-algorithmgeovisualizationgraph-drawingspatialspatial-data-analysisvalue-by-area-mapscpp
5.88 score 23 stars 33 scripts 717 downloadsMsBackendRawFileReader - Mass Spectrometry Backend for Reading Thermo Fisher Scientific raw Files
implements a MsBackend for the Spectra package using Thermo Fisher Scientific's NewRawFileReader .Net libraries. The package is generalizing the functionality introduced by the rawrr package Methods defined in this package are supposed to extend the Spectra Bioconductor package.
Last updated
massspectrometryproteomicsmetabolomics
5.48 score 6 stars 7 scriptsspecL - specL - Prepare Peptide Spectrum Matches for Use in Targeted Proteomics
provides a functions for generating spectra libraries that can be used for MRM SRM MS workflows in proteomics. The package provides a BiblioSpec reader, a function which can add the protein information using a FASTA formatted amino acid file, and an export method for using the created library in the Spectronaut software. The package is developed, tested and used at the Functional Genomics Center Zurich <https://fgcz.ch>.
Last updated
massspectrometryproteomicsddadiamass-spectrometry
5.46 score 1 stars 12 scripts 461 downloadscloudUtil - Cloud Utilization Plots
Provides means of plots for comparing utilization data of compute systems.
Last updated
2.00 score 8 scripts 188 downloads